Lizhi
Volver a la bibliotecaEntrada · LZH-005
GHRH analog · GHRH analog

Tesamorelin

Stabilized growth hormone releasing hormone analog

Ficha técnicaLZH-005
Código
GHRH analog
Semivida
~26-38 min (SC)
Vía de investigación
Subcutaneous (research)
Dianas moleculares
GHRH receptor (pituitary)
Descubrimiento / divulgación
Theratechnologies, approved 2010
Pureza objetivo
≥ 98%
Almacenamiento recomendado
−20 °C, protegido de la luz. De 2 a 8 °C tras la reconstitución.
Sinónimos
TH9507, Egrifta
Aspecto
White lyophilized powder
Solubilidad
Soluble in aqueous buffer, dilute acetic acid
Secuencia
[trans-3-hexenoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Analistas revisando el cromatograma de HPLC del lote actual
FIG. 201Analytical Lab

Identity, purity and main-peak area are checked by reversed-phase HPLC against an in-house reference standard for this sequence. The chromatogram you see on the certificate of analysis is generated at this exact bench, by the analysts who release the batch.

Técnico supervisando un reactor de acero inoxidable durante el escalado
FIG. 202Scale-up Operations

When a sequence moves from milligram research lots to multi-gram research supply, the same chemistry is transferred onto jacketed stainless reactors. Temperature, agitation and reagent equivalents are logged in real time so that the larger batch matches the analytical fingerprint of the small one.

01

Descripción general

Tesamorelin is a 44 amino acid stabilized GHRH analog, with an N-terminal trans-3-hexenoyl group that improves plasma stability.

02

Farmacología y mecanismo

Selectively acts on pituitary GHRH receptors, driving pulsatile growth hormone secretion and restoring physiological GH and IGF-1 axis rhythms.

03

Áreas de investigación

R.01
Stabilized growth hormone releasing hormone analog

Studied in visceral adipose deposition, HIV-associated lipodystrophy and cognitive or aging-related GH axis changes.

04

Notas estructurales

44 amino acid sequence with an N-terminal 3-hexenoyl modification, sharing high homology with native hGHRH.

Secuencia
[trans-3-hexenoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Uso exclusivo en investigación. No constituye asesoramiento médico ni se destina al diagnóstico o tratamiento.