Lizhi
GHRH analog · GHRH analog

Tesamorelin

Stabilized growth hormone releasing hormone analog

Fiche techniqueLZH-005
Code
GHRH analog
Demi-vie
~26-38 min (SC)
Voie de recherche
Subcutaneous (research)
Cibles moléculaires
GHRH receptor (pituitary)
Découverte / divulgation
Theratechnologies, approved 2010
Pureté cible
≥ 98 %
Conservation recommandée
−20 °C, à l'abri de la lumière. De 2 à 8 °C après reconstitution.
Synonymes
TH9507, Egrifta
Aspect
White lyophilized powder
Solubilité
Soluble in aqueous buffer, dilute acetic acid
Séquence
[trans-3-hexenoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Analystes examinant le chromatogramme HPLC du lot en cours
FIG. 201Analytical Lab

Identity, purity and main-peak area are checked by reversed-phase HPLC against an in-house reference standard for this sequence. The chromatogram you see on the certificate of analysis is generated at this exact bench, by the analysts who release the batch.

Technicien surveillant un réacteur en acier inoxydable pendant la montée en échelle
FIG. 202Scale-up Operations

When a sequence moves from milligram research lots to multi-gram research supply, the same chemistry is transferred onto jacketed stainless reactors. Temperature, agitation and reagent equivalents are logged in real time so that the larger batch matches the analytical fingerprint of the small one.

01

Vue d'ensemble

Tesamorelin is a 44 amino acid stabilized GHRH analog, with an N-terminal trans-3-hexenoyl group that improves plasma stability.

02

Pharmacologie et mécanisme

Selectively acts on pituitary GHRH receptors, driving pulsatile growth hormone secretion and restoring physiological GH and IGF-1 axis rhythms.

03

Domaines de recherche

R.01
Stabilized growth hormone releasing hormone analog

Studied in visceral adipose deposition, HIV-associated lipodystrophy and cognitive or aging-related GH axis changes.

04

Notes structurales

44 amino acid sequence with an N-terminal 3-hexenoyl modification, sharing high homology with native hGHRH.

Séquence
[trans-3-hexenoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Réservé à un usage de recherche. Ne constitue pas un avis médical et n'est destiné ni au diagnostic ni au traitement.